G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody TA335037 from OriGene Technologies | Biocompare.com

Supplier Images

G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody

OriGene Technologies' G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody was generated using GNAI2 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-GNAI2 Antibody

Product Specs
ItemG protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA335037
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetGNAI2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the middle region of human GNAI2. Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL
NCBI Full Gene NameG protein subunit alpha i2
NCBI Gene AliasesH_LUCA15.1, GIP, H_LUCA16.1, GNAI2B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!